PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_06258.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 337aa    MW: 37306.3 Da    PI: 6.4937
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_06258.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.85.2e-093375441
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.....Htvvp 41
                              +C++++ ++++  C d ++ lC++C  ++H++     H++++
  Rsa1.0_06258.1_g00004.1 33 LICERCNAQPASVRCSDERVSLCQNCDWSGHNNdatsqHKRQS 75
                             68*****************************999999999876 PP

2CCT58.62.2e-20280322143
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                              R++a++RYkeK+k RkF+K++rY sRK++A+ R RvKGrFvk+
  Rsa1.0_06258.1_g00004.1 280 RNNAVMRYKEKKKARKFDKRVRYVSRKERADVRRRVKGRFVKS 322
                              99***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.14134IPR000315B-box-type zinc finger
CDDcd000214.57E-4234No hitNo description
PROSITE profilePS501199.7413076IPR000315B-box-type zinc finger
PfamPF006432.9E-53375IPR000315B-box-type zinc finger
CDDcd000211.51E-63476No hitNo description
SMARTSM003360.273576IPR000315B-box-type zinc finger
PfamPF062032.1E-15280322IPR010402CCT domain
PROSITE profilePS5101715.1280322IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVYCRSDAAC LCLSCDRNVH SANALSKRHS RTLICERCNA QPASVRCSDE RVSLCQNCDW  60
SGHNNDATSQ HKRQSLNCYS GCPSSEELAS IWSFCMDLDF SSAGQSACEK EMGLMTIDEG  120
TGEDKTNVQN VNVDQPGTSS ALAKEFGVSE DDFCGNLIMN EMDLAFEKYD ELFGTAYNSS  180
KDLFEHGGIG SLFEKHEGSK AMQQQQQPAG SNAASEDSFM TCRTEPIICF SSQPAHSNIS  240
FSVVMGDSTS DCGASSMQKL SREITSQDET NASSHATTTR NNAVMRYKEK KKARKFDKRV  300
RYVSRKERAD VRRRVKGRFV KSGGAYDYDP MSPARSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129717.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10-like
SwissprotQ9LUA90.0COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLA0A078IHY60.0A0A078IHY6_BRANA; BnaA02g30040D protein
STRINGBra020709.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-172B-box type zinc finger protein with CCT domain